PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G28490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YB
Protein Properties Length: 182aa    MW: 19550.9 Da    PI: 7.5877
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G28490.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1344.6e-4229120596
            NF-YB   5 drflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                      + +lP+an++r+mkkvlP++aki+ +ak+++++c++ef++fv++eas+k+++e+r+ti+++d+l ++++lGf++y+ep+++y++ yre+e++
  OPUNC02G28490.1  29 NTELPMANLIRLMKKVLPGKAKIGGAAKGLTHDCAVEFVGFVGDEASEKAKAEHRRTIAPEDYLGSFGDLGFDRYIEPMEAYIHGYREFERA 120
                      789**************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.0E-2626120IPR009072Histone-fold
PfamPF008081.3E-133090IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471138.0E-2431146IPR009072Histone-fold
PRINTSPR006154.0E-65977No hitNo description
PRINTSPR006154.0E-67896No hitNo description
PRINTSPR006154.0E-697115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MAGNKKRGGR NMEVQKKAAG SDGEGGVTNT ELPMANLIRL MKKVLPGKAK IGGAAKGLTH  60
DCAVEFVGFV GDEASEKAKA EHRRTIAPED YLGSFGDLGF DRYIEPMEAY IHGYREFERA  120
GGNRRVVPTA ATTPLTPSGP TFTDAELQFL RSVIPSISDD EYNGSSSAKD GYGYGYGYGK  180
NM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-2232116993NF-YB
4awl_B3e-22321161094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-22321161094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3002180.0AJ300218.1 Oryza sativa nf-yb1 gene and nf-YB1 gene.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624776.12e-92PREDICTED: nuclear transcription factor Y subunit B-1
SwissprotQ6Z3482e-94NFYB1_ORYSJ; Nuclear transcription factor Y subunit B-1
TrEMBLA0A0E0K4P71e-132A0A0E0K4P7_ORYPU; Uncharacterized protein
STRINGBGIOSGA005700-PA1e-92(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP136592631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.22e-22nuclear factor Y, subunit B6